PtX™ Protein A

Protein A is produced in Nicotiana benthamiana plants and provides a versatile and economical means for isolating, detecting, and purifying antibodies.

100 µg Sample Size     |     Catalogue Number: CBT_P0001

Download: SDS / Datasheet

Share:

Protein A is a highly stable 42kDa surface protein found in the cell walls of several strains of Staphylococcus aureus. It consists of a single polypeptide chain, composed of five homologous IgG-binding domains that strongly bind Fc regions of IgG from several mammalian species. Due to its high IgG binding affinity, Protein A is commonly used as a reliable method for purifying total IgG from crude protein mixtures.

Additional information

Available Unit Size

0.1mg, 1mg, 10mg, 100mg, 200mg

Key Benefits

This product is a plant-made, recombinant protein, which offers several advantages including:

  • Binding and detection of several species’ immunoglobulins.
  • Recombinantly made protein for reproducible results.
  • No animals or animal products are used in the development of this protein.
  • Azide and BSA free.

For more information on plant-made, recombinant monoclonal proteins click here.

Images

Figure 1. PtX™ Recombinant Protein A analysed by SDS-PAGE and Coomassie stain. Arrow indicating protein band at 42KDa.

Datasheet

Product Name PtX™ Recombinant Protein A
Catalogue Number CBT_P0001
Expression Host Nicotiana benthamiana plants
Clonality N/A
Species Staphylococcus aureus
Tag 6xhis tag (C-terminal)
Reporter Protein N/A
Description This product is recombinantly produced in Nicotiana benthamiana plants via Agrobacterium tumefaciens mediated infiltration.
Sequence MKKKNIYSIRKLGVGIASVTLGTLLISGGVTPAANAA QHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQ SANVLGEAQKLNDSQAPKADAQQNNFDKDQQSAFYEI LNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNE SQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQS
Verified Applications ELISA (1:10 000-1:30 000)
Verified Species Immunoglobulin Affinity   Human IgG1 (++++) Rabbit IgG (+++) Mouse IgG1 (+) Mouse IgG2a (++++) Alpaca IgG2b (++++)
Concentration 1.0 mg/ml
Form Liquid
Colour Clear to light yellow
Preparation Ready to use
Storage Short term (up to one week): 2 – 8 °C Long term: Aliquot and store at – 20 °C Store immediately. Aliquot and avoid multiple freeze thaw cycles.
Storage buffer 0.1  M Phosphate Buffered Saline, pH 7.4 Preservative: None
Purification notes This product was purified using Immobilised metal affinity chromatography (IMAC).
Purity ≥ 85 % as determined by SDS-PAGE
General notes If for any reason the product does not perform as specified, please contact our scientific support team for assistance by emailing sales@capebiologix.com.

PtX™ | Plant-Based Expression

The biotechnology behind the development and manufacture of this product, transient plant-based expression, effectively turns Nicotiana benthamiana plants into single use, biodegradable bioreactors. Infiltrating this plant species with Agrobacterium tumefaciens cells, transformed with our proprietary plant expression vectors, allows rapid production of a wide variety of recombinant proteins. Plants are harvested and proteins extracted by various stages of filtration, clarification, purification, and polishing – resulting in a highly functional final product.

Visit our Technology page to learn more.

Important!

  • For Research Use Only.
  • Not for diagnostic or therapeutic use.
  • Not for resale without express authorization.
  • Trademark.

  Sign up for our newsletter

Click Here