PtX™ Rabbit Anti-GST

Recombinant rabbit monoclonal antibody against native and denatured forms of glutathione S-transferase (GST). PtX™ Rabbit Anti-glutathione S-transferase antibody is produced in Nicotiana benthamiana plants and used in various immunoassays for the detection of purified GST and GST-tagged recombinant proteins.

100 µg Sample Size     |     Catalogue Number: CBT_A0001

Download: SDS / Datasheet

Share:

Glutathione S-transferase (GST) is a detoxification enzyme which catalyses the conjugation of the reduced form of glutathione to hydrophobic and electrophilic compounds of xenobiotic substrates, thereby protecting the host against toxic foreign chemicals and oxidative stress. The GST superfamily can be categorized into cytosolic, mitochondrial and microsomal GST subfamilies. GST-tags are often fused to target recombinant proteins to facilitate the purification and study of the target proteins by antibodies directed against the GST tags.

Additional information

Available Unit Size

0.1mg, 1mg, 10mg, 100mg, 200mg

Key Benefits

This product is a plant-made, recombinant monoclonal antibody, which offers several advantages including:

  • Can detect recombinant GST in native and denatured forms.
  • Protein is fused at the genetic level for increased reproducibility of results.
  • No animals or animal products are used in the development of this protein.
  • BSA and Azide free.

For more information on plant-made, recombinant monoclonal antibodies click here.

Datasheet

Product Name PtX™ Rabbit Anti-GST Recombinant Antibody
Catalogue Number CBT_A0001
Expression Host Nicotiana benthamiana plants
Clonality Monoclonal, recombinant
Species and Isotype Rabbit IgG1
Tag None
Reporter Protein None
Description This product is a full-length Rabbit IgG1 recombinant antibody specific to the GST Tag. It was produced in Nicotiana benthamiana plants via Agrobacterium tumefaciens mediated infiltration.
Target name Glutathione-S-Transferase (GST)
Target sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDE
GDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRY
IADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAY
SKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHV
THPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEA
IPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
Verified Applications Western blot (1:000-1:10 000)
ELISA (1:20 000-1:100 000)
Concentration 1.0 mg/ml
Form Liquid
Colour Clear to light yellow
Preparation Ready to use
Storage Short term (up to one week): 2 – 8 °C
Long term: Aliquot and store at – 20 °C
Store immediately. Aliquot and avoid multiple freeze thaw cycles.
Storage buffer 0.1 M Phosphate Buffered Saline, pH 7.4
Preservative: None
Purification notes This product was purified using Protein A affinity chromatography.
Purity ≥ 90 % as determined by SDS-PAGE
General notes If for any reason the product does not perform as specified, please contact our scientific support team for assistance by emailing sales@capebiologix.com.

Images


Figure 1. Western blot of decreasing amounts of GST antigen (28 kDa) detected with PtXTM Rabbit Anti-GST Recombinant Antibody at 1:5000 and an HRP conjugated anti-rabbit secondary antibody.

PtX™ | Plant-Based Expression

The biotechnology behind the development and manufacture of this product, transient plant-based expression, effectively turns Nicotiana benthamiana plants into single use, biodegradable bioreactors. Infiltrating this plant species with Agrobacterium tumefaciens cells, transformed with our proprietary plant expression vectors, allows rapid production of a wide variety of recombinant proteins. Plants are harvested and proteins extracted by various stages of filtration, clarification, purification, and polishing – resulting in a highly functional final product.

Visit our Technology page to learn more.

Important!

  • For Research Use Only.
  • Not for diagnostic or therapeutic use.
  • Not for resale without express authorization.
  • Trademark.

  Sign up for our newsletter

Click Here